PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03679.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 286aa    MW: 31981.6 Da    PI: 10.0709
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03679.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.11.4e-1761151194
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f k  + +d++++ r +l+ +f++++g+ k++   ltl  ++g +W+v++  ++ +++  l+kGWkeF+kangLk+g+ ++++  +
  Rsa1.0_03679.1_g00003.1  61 FMKLKLAHDSFRKYRQYLSVPFMRANGMTKPG--LLTLVGKDGVKWKVNMYEERFGSSLCLGKGWKEFAKANGLKTGEYFTLESAW 144
                              7888999*******************999766..7***************55777778*************************666 PP

                              SSEE..EE CS
                       B3  87 rsefelvv 94 
                               +++ +++
  Rsa1.0_03679.1_g00003.1 145 -KKEIPML 151
                              .4444555 PP

2B343.36.4e-141972801096
                              HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EE CS
                       B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvv 94 
                                k + l lp +f++++g+kk +  ++tl  ++g +W  +l    ++g++ ++ GW++F++ang+k gD++ + ++++ +++ + +
  Rsa1.0_03679.1_g00003.1 197 DVKACTLHLPSEFVTTIGIKKLG--KITLLGKDGMKWWGYL--LSRKGTVAIGIGWRNFCEANGVKLGDSFSLVFINEeEDTGPIF 278
                              456789***********999755..8***************..888899**********************999998778888887 PP

                              EE CS
                       B3  95 kv 96 
                              k+
  Rsa1.0_03679.1_g00003.1 279 KF 280
                              76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-1655151IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.16E-1757154IPR015300DNA-binding pseudobarrel domain
CDDcd100172.45E-1659141No hitNo description
PfamPF023621.0E-1561151IPR003340B3 DNA binding domain
SMARTSM010196.1E-2161157IPR003340B3 DNA binding domain
PROSITE profilePS5086312.74661157IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-15185271IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-16186271IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.1E-14188284IPR003340B3 DNA binding domain
PROSITE profilePS5086311.885188283IPR003340B3 DNA binding domain
PfamPF023624.1E-12197281IPR003340B3 DNA binding domain
CDDcd100171.86E-9201281No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MNNSETNCPL ALVTASNVRE DTQCLRQDLC PTESIHDGTQ GDNNKKKRRG RSPTSPSQKQ  60
FMKLKLAHDS FRKYRQYLSV PFMRANGMTK PGLLTLVGKD GVKWKVNMYE ERFGSSLCLG  120
KGWKEFAKAN GLKTGEYFTL ESAWKKEIPM LSLVNTESTS DRKQRGESSK AMEKDRSTDT  180
SSIVQNRVVT LALETKDVKA CTLHLPSEFV TTIGIKKLGK ITLLGKDGMK WWGYLLSRKG  240
TVAIGIGWRN FCEANGVKLG DSFSLVFINE EEDTGPIFKF SPNSGN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14448KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013745925.10.0PREDICTED: B3 domain-containing protein REM12-like
SwissprotP0CAP48e-91REM12_ARATH; B3 domain-containing protein REM12
TrEMBLA0A078JGZ90.0A0A078JGZ9_BRANA; BnaCnng48570D protein
STRINGBra032076.1-P1e-140(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142671121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.12e-83B3 family protein